Yadanzioside G

CAS No. 95258-17-6

Yadanzioside G ( )

Catalog No. M31503 CAS No. 95258-17-6

Yadanzioside G has antileukemic activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 603 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    Yadanzioside G
  • Note
    Research use only, not for human use.
  • Brief Description
    Yadanzioside G has antileukemic activity.
  • Description
    Yadanzioside G has antileukemic activity.
  • Synonyms
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    95258-17-6
  • Formula Weight
    768.8
  • Molecular Formula
    C36H48O18
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • SJ572403

    SJ572403 is an inhibitor of disordered protein p27.

  • Lilial

    Lilial (a trade name for lily aldehyde, also known as lysmeral) is a chemical compound commonly used as a perfume in cosmetic preparations and laundry powders, often under the name butylphenyl methylpropional.?

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.